SKU: 53612600367

Human Urokinase Protein, His tag

Sale price$180.00 Regular price$200.00
Save 10%

Pay in installments of $50.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 20 - Jul 25

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Urokinase Protein, His tagProduct Specification Species Human Synonyms Urokinase type plasminogen activator, U plasminogen activator, uPA, PLAU Accession P00749 Amino Acid Sequence Protein sequence (P00749, Ser21 Leu431, with C His tag)

Product Specification


Species Human
Synonyms Urokinase-type plasminogen activator, U-plasminogen activator, uPA, PLAU
Accession P00749
Amino Acid Sequence

Protein sequence (P00749, Ser21-Leu431, with C-His tag) SNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKLLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL

Expression System HEK293
Molecular Weight Predicted MW: 48.1 kDa Observed MW: 54 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Urokinase - type plasminogen activator is a serine protease that plays a crucial role in the fibrinolytic system. It is mainly produced and secreted by various cells, such as endothelial cells and monocytes. u - PA specifically converts plasminogen into plasmin, which is capable of degrading fibrin clots and extracellular matrix proteins. This process is essential for maintaining the balance of blood coagulation and fibrinolysis, as well as for tissue remodeling and wound healing. Dysregulation of u - PA has been implicated in many pathological conditions, including thrombosis, cancer metastasis, and inflammatory diseases. Therefore, u - PA is an important target for the development of drugs to treat these diseases.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 53612600367

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 26 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazon Customer
Louisville, US
★★★★★ 4
Excellent product
Color: Medium
Excellent product, really works & looks good
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 16, 2026
J
Verified Purchase
Jolene
Belleville, US
★★★★★ 5
Beautiful sunscreen
Color: Medium
The perfect skincare/sunscreen/tint! I am a huge fan of tinted moisturizers and struggle with finding the correct color, texture and staying power. Color science is a clear winner here. A luxurious product, creamy, perfect moisture, coverage and the perfect tone. A++ will buy again…..and again.❤️
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 3, 2024
M
Verified Purchase
Ms. M
Phoenix, US
★★★★★ 3
I love this product
Color: Medium
I love this product. Best tinted moisturizer I've ever used. My low star rating is for the product container. On this tube (and the last one I ordered as well) the top separates from the base. When this happens, I can't pump the product out. I have to fiddle around with it quite a bit to get it reattached and then fiddle around some more to get it pumping again. At the price of this product, this issue should really be addressed. I can't believe I'm the only one who is dealing with this. Especially since the last two tubes performed in the same way.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 5, 2017
T
Verified Purchase
Tessa R.
Louisville, US
★★★★★ 5
SO GOOD
Color: Light
This product is so velvety and goes onto the skin so nicely. As per usual, it feels like natural skin but it has great coverage -- I was pleasantly surprised. I don't know what Colorscience does, but they have the magic. I am a forever customer of all of their products. It's a plus that their products are good for the skin AND have SPF as well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 8, 2024
A
Verified Purchase
Amazon Customer
Waukegan, US
★★★★★ 5
Holy grail of tinted spf
Color: Light
I’ve tried numerous brands that I won’t mention but at least 20…. and this little tube of tint was my answer. I have very light skin and every other brand has a light shade that isn’t light enough or is too yellow or orange. Well the tint du soliel in light is the perfect answer to my fair pink undertone skin. It is the most beautiful consistency and I apply it with a beauty blender (yes I lose some product with the blender method - but the final result is an EVEN beautiful light and natural tint that literally looks like skin itself- absolutely no streaking or cakiness). It was remarkably easy to blend and immediately set to its beautiful satin finish. I’m just floored at how good my face looks. It’s very pricey at $60 for just 1.0 oz, but with this formula and aesthetic, it is absolutely worth it. I just ordered another one even though I’m not even half way through my first bottle! I’m a fan for life. Try this tint du soleil!!!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 10, 2024

recommand products